- TM4SF1/L6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82854
- TM4SF1/L6
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: GPLCLDSLGQ WNYTFASTEG QYLLDTSTWS ECTEPKHIVE WNVSLFSI
- Human
- Unconjugated
- L6, M3S1, H-L6, TAAL6
- transmembrane 4 L six family member 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer, Cell Cycle and Replication
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
Specifications/Features
Available conjugates: Unconjugated